PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G04860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 295aa    MW: 32296.2 Da    PI: 7.9882
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G04860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++k  G g+W++ ++  g+ R++k+c++rw +yl
  ORUFI11G04860.1 14 KGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding60.82.8e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
  ORUFI11G04860.1  67 RGNFTEEEDELIIKLHELLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.466961IPR017930Myb domain
SMARTSM007178.8E-131363IPR001005SANT/Myb domain
SuperFamilySSF466892.22E-2913108IPR009057Homeodomain-like
PfamPF002492.3E-141461IPR001005SANT/Myb domain
CDDcd001674.69E-101661No hitNo description
PROSITE profilePS5129429.5162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2865116IPR009057Homeodomain-like
SMARTSM007172.0E-1866114IPR001005SANT/Myb domain
PfamPF002491.7E-1767111IPR001005SANT/Myb domain
CDDcd001674.79E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIK ANGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHELLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLARG  120
VDPQTHRPLN AAADHHHQQQ LQAPRRFAAA PAGHHHHHPD HFAVLSNSPE ACSHSSDDEP  180
SSATPPPPPR HLGIDLNLSI SLAPYQPQDQ TSEPMKQEED DEASATANGA GNAAMTTTAT  240
TAAVCLCLNR LGLHGGEVCS CGRGGAPSMQ ASTHMFRFIT PLGGSHHNSS STTMT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1340440.0AC134044.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBa0019D06 map S10616A, complete sequence.
GenBankAC1357940.0AC135794.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0084H09, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615594.10.0PREDICTED: myb-related protein 308
SwissprotP813937e-91MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0E0R4Z30.0A0A0E0R4Z3_ORYRU; Uncharacterized protein
STRINGBGIOSGA034924-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-87myb domain protein 4